CTPS polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of 721 B lymphoblast cell lysate with CTPS polyclonal antibody (Cat # PAB30015) at 5 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of Capan-1 cell lysate with CTPS polyclonal antibody (Cat # PAB30015) at 1:1000 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with CTPS polyclonal antibody (Cat # PAB30015) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human CTPS.
Immunogen
A synthetic peptide corresponding to N-terminus of human CTPS.
Sequence
SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR
Host
Rabbit
Theoretical MW (kDa)
67
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of 721 B lymphoblast cell lysate with CTPS polyclonal antibody (Cat # PAB30015) at 5 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of Capan-1 cell lysate with CTPS polyclonal antibody (Cat # PAB30015) at 1:1000 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with CTPS polyclonal antibody (Cat # PAB30015) at 4-8 ug/mL working concentration. -
Gene Info — CTPS
Entrez GeneID
1503GeneBank Accession#
NM_001905Protein Accession#
NP_001896;P17812Gene Name
CTPS
Gene Alias
-
Gene Description
CTP synthase
Omim ID
123860Gene Ontology
HyperlinkGene Summary
The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types [provided by RefSeq
Other Designations
OTTHUMP00000006322|OTTHUMP00000006323|cytidine 5'-triphosphate synthetase|cytidine 5-prime triphosphate synthetase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com