Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CREB3L2 polyclonal antibody

  • Catalog # : PAB30010
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human CREB3L2.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human CREB3L2.
  • Sequence:
  • HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 57
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human fetal muscle tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human fetal brain tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human fetal heart tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human fetal lung tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Jurkat cell lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1.25 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with CREB3L2 polyclonal antibody (Cat # PAB30010) at 4-8 ug/mL working concentration.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Protein Accession#:
  • NP_919047;Q70SY1
  • Gene Name:
  • CREB3L2
  • Gene Alias:
  • BBF2H7,MGC131709,MGC71006
  • Gene Description:
  • cAMP responsive element binding protein 3-like 2
  • Gene Summary:
  • CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).[supplied by OMIM
  • Other Designations:
  • B-ZIB transcription factor,FUS/BBF2H7 protein,TCAG_1951439,basic transcription factor 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook