CREB3L2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human fetal muscle tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.
Western Blot (Tissue lysate)
Western Blot analysis of human fetal lung tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.
Western Blot (Tissue lysate)
Western Blot analysis of human fetal brain tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.
Western Blot (Tissue lysate)
Western Blot analysis of human fetal heart tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1.25 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with CREB3L2 polyclonal antibody (Cat # PAB30010) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human CREB3L2.
Immunogen
A synthetic peptide corresponding to N-terminus of human CREB3L2.
Sequence
HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
Host
Rabbit
Theoretical MW (kDa)
57
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human fetal muscle tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.Western Blot (Tissue lysate)
Western Blot analysis of human fetal lung tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.Western Blot (Tissue lysate)
Western Blot analysis of human fetal brain tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.Western Blot (Tissue lysate)
Western Blot analysis of human fetal heart tissue lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with CREB3L2 polyclonal antibody (Cat # PAB30010) at 1.25 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with CREB3L2 polyclonal antibody (Cat # PAB30010) at 4-8 ug/mL working concentration. -
Gene Info — CREB3L2
Entrez GeneID
64764GeneBank Accession#
NM_194071Protein Accession#
NP_919047;Q70SY1Gene Name
CREB3L2
Gene Alias
BBF2H7, MGC131709, MGC71006
Gene Description
cAMP responsive element binding protein 3-like 2
Omim ID
608834Gene Ontology
HyperlinkGene Summary
CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).[supplied by OMIM
Other Designations
B-ZIB transcription factor|FUS/BBF2H7 protein|TCAG_1951439|basic transcription factor 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com