COX15 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with COX15 polyclonal antibody (Cat # PAB30006) at 5 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of human fibroblast mitochondria with COX15 polyclonal antibody (Cat # PAB30006) at 1:1000 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human muscle with COX15 polyclonal antibody (Cat # PAB30006) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human COX15.
Immunogen
A synthetic peptide corresponding to N-terminus of human COX15.
Sequence
DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
Host
Rabbit
Theoretical MW (kDa)
44
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with COX15 polyclonal antibody (Cat # PAB30006) at 5 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of human fibroblast mitochondria with COX15 polyclonal antibody (Cat # PAB30006) at 1:1000 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human muscle with COX15 polyclonal antibody (Cat # PAB30006) at 4-8 ug/mL working concentration. -
Gene Info — COX15
Entrez GeneID
1355GeneBank Accession#
NM_004376Protein Accession#
NP_004367;Q7KZN9-2Gene Name
COX15
Gene Alias
-
Gene Description
COX15 homolog, cytochrome c oxidase assembly protein (yeast)
Gene Ontology
HyperlinkGene Summary
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region. [provided by RefSeq
Other Designations
COX15 homolog|OTTHUMP00000020263|OTTHUMP00000020264|cytochrome c oxidase subunit 15
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com