Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BHMT polyclonal antibody

  • Catalog # : PAB29977
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human BHMT.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human BHMT.
  • Sequence:
  • AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 45
  • Reactivity:
  • Human, Rat
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of rat liver tissue lysate with BHMT polyclonal antibody (Cat # PAB29977) at 1:1000 dilution.
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human fetal muscle tissue lysate with BHMT polyclonal antibody (Cat # PAB29977) at 2.5 ug/mL working concentration.
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of 293T cell lysate with BHMT polyclonal antibody (Cat # PAB29977) at 1 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with BHMT polyclonal antibody (Cat # PAB29977) at 4-8 ug/mL working concentration.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 635
  • Protein Accession#:
  • NP_001704;Q93088
  • Gene Name:
  • BHMT
  • Gene Alias:
  • -
  • Gene Description:
  • betaine-homocysteine methyltransferase
  • Gene Summary:
  • This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. [provided by RefSeq
  • Other Designations:
  • betaine homocysteine methyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook