BHMT polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of rat liver tissue lysate with BHMT polyclonal antibody (Cat # PAB29977) at 1:1000 dilution.
Western Blot (Tissue lysate)
Western Blot analysis of human fetal muscle tissue lysate with BHMT polyclonal antibody (Cat # PAB29977) at 2.5 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of 293T cell lysate with BHMT polyclonal antibody (Cat # PAB29977) at 1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with BHMT polyclonal antibody (Cat # PAB29977) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human BHMT.
Immunogen
A synthetic peptide corresponding to N-terminus of human BHMT.
Sequence
AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
Host
Rabbit
Theoretical MW (kDa)
45
Reactivity
Human, Rat
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of rat liver tissue lysate with BHMT polyclonal antibody (Cat # PAB29977) at 1:1000 dilution.Western Blot (Tissue lysate)
Western Blot analysis of human fetal muscle tissue lysate with BHMT polyclonal antibody (Cat # PAB29977) at 2.5 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of 293T cell lysate with BHMT polyclonal antibody (Cat # PAB29977) at 1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with BHMT polyclonal antibody (Cat # PAB29977) at 4-8 ug/mL working concentration. -
Gene Info — BHMT
Entrez GeneID
635GeneBank Accession#
NM_001713Protein Accession#
NP_001704;Q93088Gene Name
BHMT
Gene Alias
-
Gene Description
betaine-homocysteine methyltransferase
Omim ID
602888Gene Ontology
HyperlinkGene Summary
This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. [provided by RefSeq
Other Designations
betaine homocysteine methyltransferase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com