Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACCN3 polyclonal antibody

  • Catalog # : PAB29970
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human ACCN3.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human ACCN3.
  • Sequence:
  • VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 58
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human kidney tissue lysate with ACCN3 polyclonal antibody (Cat # PAB29970) at 2.5 ug/mL working concentration.
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human fetal lung tissue lysate with ACCN3 polyclonal antibody (Cat # PAB29970) at 1 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with ACCN3 polyclonal antibody (Cat # PAB29970) at 4-8 ug/mL working concentration.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9311
  • Protein Accession#:
  • NP_004760;Q9UHC3
  • Gene Name:
  • ACCN3
  • Gene Alias:
  • ASIC3,DRASIC,SLNAC1,TNaC1
  • Gene Description:
  • amiloride-sensitive cation channel 3
  • Gene Summary:
  • This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and ACCN1 has been observed as proton-gated channels sensitive to gadolinium. Alternative splicing of this gene generates three transcript variants encoding distinct isoforms. [provided by RefSeq
  • Other Designations:
  • amiloride-sensitive cation channel 3, testis,modulatory subunit of ASIC2a,proton-gated cation channel subunit,testis sodium channel 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook