APOBEC3G polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Daudi cell lysate with APOBEC3G polyclonal antibody (Cat # PAB29968) at 0.2-1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with APOBEC3G polyclonal antibody (Cat # PAB29968) at 4-8 ug/mL working concentration.
Immunofluorescence
Immunofluorescent staining of human liver with APOBEC3G polyclonal antibody (Cat # PAB29968) at 1:100 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human APOBEC3G.
Immunogen
A synthetic peptide corresponding to N-terminus of human APOBEC3G.
Sequence
AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
Host
Rabbit
Theoretical MW (kDa)
46
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunofluorescence (1:100)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Daudi cell lysate with APOBEC3G polyclonal antibody (Cat # PAB29968) at 0.2-1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with APOBEC3G polyclonal antibody (Cat # PAB29968) at 4-8 ug/mL working concentration.Immunofluorescence
Immunofluorescent staining of human liver with APOBEC3G polyclonal antibody (Cat # PAB29968) at 1:100 dilution. -
Gene Info — APOBEC3G
Entrez GeneID
60489GeneBank Accession#
NM_021822Protein Accession#
NP_068594;Q9HC16Gene Name
APOBEC3G
Gene Alias
ARP9, CEM15, FLJ12740, MDS019, bK150C2.7, dJ494G10.1
Gene Description
apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
Omim ID
607113Gene Ontology
HyperlinkGene Summary
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq
Other Designations
DNA dC->dU editing enzyme|OTTHUMP00000028911|phorbolin-like protein MDS019
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com