Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APOBEC3G polyclonal antibody

  • Catalog # : PAB29968
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human APOBEC3G.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human APOBEC3G.
  • Sequence:
  • AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 46
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Recommend Usage:
  • Immunofluorescence (1:100)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Daudi cell lysate with APOBEC3G polyclonal antibody (Cat # PAB29968) at 0.2-1 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with APOBEC3G polyclonal antibody (Cat # PAB29968) at 4-8 ug/mL working concentration.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human liver with APOBEC3G polyclonal antibody (Cat # PAB29968) at 1:100 dilution.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Protein Accession#:
  • NP_068594;Q9HC16
  • Gene Name:
  • APOBEC3G
  • Gene Alias:
  • ARP9,CEM15,FLJ12740,MDS019,bK150C2.7,dJ494G10.1
  • Gene Description:
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
  • Gene Summary:
  • This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq
  • Other Designations:
  • DNA dC->dU editing enzyme,OTTHUMP00000028911,phorbolin-like protein MDS019
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook