ARRB2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of mouse left ventricle heart tissue lysate with ARRB2 polyclonal antibody (Cat # PAB29967) at 1:1000 dilution.
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with ARRB2 polyclonal antibody (Cat # PAB29967) at 1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with ARRB2 polyclonal antibody (Cat # PAB29967) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human ARRB2.
Immunogen
A synthetic peptide corresponding to internal region of human ARRB2.
Sequence
RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
Host
Rabbit
Theoretical MW (kDa)
46
Reactivity
Human, Mouse
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of mouse left ventricle heart tissue lysate with ARRB2 polyclonal antibody (Cat # PAB29967) at 1:1000 dilution.Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with ARRB2 polyclonal antibody (Cat # PAB29967) at 1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with ARRB2 polyclonal antibody (Cat # PAB29967) at 4-8 ug/mL working concentration. -
Gene Info — ARRB2
Entrez GeneID
409GeneBank Accession#
NM_199004Protein Accession#
NP_945355;P32121Gene Name
ARRB2
Gene Alias
ARB2, ARR2, BARR2, DKFZp686L0365
Gene Description
arrestin, beta 2
Omim ID
107941Gene Ontology
HyperlinkGene Summary
Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq
Other Designations
arrestin 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com