Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STOM polyclonal antibody

  • Catalog # : PAB29945
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human STOM.
  • Immunogen:
  • A synthetic peptide corresponding to C-terminus of human STOM.
  • Sequence:
  • LQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRY
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 32
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Recommend Usage:
  • Immunofluorescence (1:150)
    Western Blot (1 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of HeLa cell lysate with STOM polyclonal antibody (Cat # PAB29945) at 1 ug/mL working concentration.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of HeLa cells with STOM polyclonal antibody (Cat # PAB29945) at 1:150 dilution.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2040
  • Protein Accession#:
  • NP_004090;P27105
  • Gene Name:
  • STOM
  • Gene Alias:
  • BND7,EPB7,EPB72
  • Gene Description:
  • stomatin
  • Other Designations:
  • OTTHUMP00000022024,OTTHUMP00000022025,OTTHUMP00000064035,erythrocyte membrane protein band 7.2 (stomatin)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook