Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HNRNPH1 polyclonal antibody

  • Catalog # : PAB29941
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPH1.
  • Immunogen:
  • A synthetic peptide corresponding to internal region of human HNRNPH1.
  • Sequence:
  • FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 49
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Recommend Usage:
  • Immunofluorescence (1:200)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (5 ug/mL)
    Immunoprecipitation (1:4000)
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of HepG2 cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 0.2-1 ug/mL working concentration.
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of 721 B lymphoblast cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1 ug/mL working concentration.
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Jurkat cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1 ug/mL working concentration.
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of MCF7 cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1 ug/mL working concentration.
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Lane 1: 20 ug HeLa S3 cell lysate, Lane 2: 20 ug MCF7 cell lysate and Lane 3: 20 ug K562 cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1:4000 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 5 ug/mL working concentration.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of MCF7 cells with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1:200 dilution.
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG and Lane 4: hn-RNPH1 ppt. k562 sample with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1:4000 dilution.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3187
  • Protein Accession#:
  • NP_005511;P31943
  • Gene Name:
  • HNRNPH1
  • Gene Alias:
  • DKFZp686A15170,HNRPH,HNRPH1,hnRNPH
  • Gene Description:
  • heterogeneous nuclear ribonucleoprotein H1 (H)
  • Gene Summary:
  • This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000161513,heterogeneous nuclear ribonucleoprotein H1
  • RSS
  • YouTube
  • Linkedin
  • Facebook