Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CENPN polyclonal antibody

  • Catalog # : PAB29940
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human CENPN.
  • Immunogen:
  • A synthetic peptide corresponding to internal region of human CENPN.
  • Sequence:
  • SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 41
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Recommend Usage:
  • Immunofluorescence (1:250)
    Western Blot (0.2-1 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Jurkat cell lysate with CENPN polyclonal antibody (Cat # PAB29940) at 0.2-1 ug/mL working concentration.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of HeLa (A), Huh7 (B) and MCF7 (C) cells with CENPN polyclonal antibody (Cat # PAB29940) at 1:250 dilution.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Protein Accession#:
  • NP_001094095;Q96H22
  • Gene Name:
  • CENPN
  • Gene Alias:
  • BM039,C16orf60,CENP-N,FLJ13607,FLJ22660
  • Gene Description:
  • centromere protein N
  • Gene Summary:
  • The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000174973,OTTHUMP00000174974
  • RSS
  • YouTube
  • Linkedin
  • Facebook