Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHI3L1 polyclonal antibody

  • Catalog # : PAB29938
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human CHI3L1.
  • Immunogen:
  • A synthetic peptide corresponding to internal region of human CHI3L1.
  • Sequence:
  • LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 42
  • Reactivity:
  • Human, Viruses
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Recommend Usage:
  • Immunofluorescence (1:2000)
    Western Blot (0.2-1 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of HepG2 cell lysate with CHI3L1 polyclonal antibody (Cat # PAB29938) at 0.2-1 ug/mL working concentration.
  • Immunofluorescence
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunofluorescence
  • Gene Information
  • Entrez GeneID:
  • 1116
  • Protein Accession#:
  • NP_001267;P36222
  • Gene Name:
  • CHI3L1
  • Gene Alias:
  • ASRT7,DKFZp686N19119,FLJ38139,GP39,HC-gp39,HCGP-3P,YKL40,YYL-40
  • Gene Description:
  • chitinase 3-like 1 (cartilage glycoprotein-39)
  • Gene Summary:
  • Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000039087,cartilage glycoprotein-39,chitinase 3-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook