Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDYL polyclonal antibody

  • Catalog # : PAB29937
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human CDYL.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human CDYL.
  • Sequence:
  • YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 60
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Recommend Usage:
  • Immunofluorescence (4 ug/mL)
    Western Blot (0.2-1 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of transfected 293T cell lysate with CDYL polyclonal antibody (Cat # PAB29937) at 0.2-1 ug/mL working concentration.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of HeLa (A) and MDA-MB-231 (B) cells with CDYL polyclonal antibody (Cat # PAB29937) at 4 ug/mL working concentration.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9425
  • Protein Accession#:
  • NP_004815;Q9Y232
  • Gene Name:
  • CDYL
  • Gene Alias:
  • CDYL1,DKFZp586C1622,MGC131936
  • Gene Description:
  • chromodomain protein, Y-like
  • Gene Summary:
  • Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. [provided by RefSeq
  • Other Designations:
  • CDY-like, autosomal,OTTHUMP00000015984,bA620A17.2 (chromodomain protein, Y chromosome-like),chromodomain protein, Y chromosome-like,chromodomain protein, Y chromosome-like, isoform b,testis-specific chromodomain Y-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook