MXI1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human fetal brain tissue lysate with MXI1 polyclonal antibody (Cat # PAB29927) at 0.2-1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung with MXI1 polyclonal antibody (Cat # PAB29927) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human MXI1.
Immunogen
A synthetic peptide corresponding to internal region of human MXI1.
Sequence
LNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
Host
Rabbit
Theoretical MW (kDa)
26
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human fetal brain tissue lysate with MXI1 polyclonal antibody (Cat # PAB29927) at 0.2-1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung with MXI1 polyclonal antibody (Cat # PAB29927) at 4-8 ug/mL working concentration. -
Gene Info — MXI1
Entrez GeneID
4601GeneBank Accession#
NM_130439Protein Accession#
NP_569157;P50539Gene Name
MXI1
Gene Alias
MAD2, MGC43220, MXD2, MXI, bHLHc11
Gene Description
MAX interactor 1
Gene Ontology
HyperlinkGene Summary
Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally. [provided by RefSeq
Other Designations
MAX dimerization protein 2|MAX interacting protein 1|MAX-interacting protein 1|Max-related transcription factor|OTTHUMP00000020467|OTTHUMP00000020468|OTTHUMP00000020469
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com