Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CPS1 polyclonal antibody

  • Catalog # : PAB29925
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human CPS1.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human CPS1.
  • Sequence:
  • QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 165
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot (1.25 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human fetal liver tissue lysate with CPS1 polyclonal antibody (Cat # PAB29925) at 1.25 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with CPS1 polyclonal antibody (Cat # PAB29925) at 4-8 ug/mL working concentration.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1373
  • Protein Accession#:
  • NP_001866;P31327
  • Gene Name:
  • CPS1
  • Gene Alias:
  • -
  • Gene Description:
  • carbamoyl-phosphate synthetase 1, mitochondrial
  • Gene Summary:
  • The protein encoded by this gene is an enzyme that catalyzes the first committed step of the hepatic urea cycle, which is important in the removal of excess urea from cells. There are two isozymes of this enzyme, and the encoded protein is the mitochondrial form. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. [provided by RefSeq
  • Other Designations:
  • CPSase I,carbamoyl-phosphate synthetase 1,carbamoylphosphate synthetase I
  • RSS
  • YouTube
  • Linkedin
  • Facebook