Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MBNL1 polyclonal antibody

  • Catalog # : PAB29919
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human MBNL1.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 211-260 of human MBNL1.
  • Sequence:
  • AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 38
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:250)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to one week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Jurkat cell lysate with MARVELD3 polyclonal antibody MBNL1 polyclonal antibody (Cat # PAB29919).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of (A) and (B) human heart with MBNL1 polyclonal antibody (Cat # PAB29919).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4154
  • Gene Name:
  • MBNL1
  • Gene Alias:
  • DKFZp686P06174,EXP,EXP35,EXP40,EXP42,KIAA0428,MBNL
  • Gene Description:
  • muscleblind-like (Drosophila)
  • Other Designations:
  • muscleblind-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook