Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MGST2 polyclonal antibody

  • Catalog # : PAB29911
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human MGST2.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 1-50 of human MGST2.
  • Sequence:
  • MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 16
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:250)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to one week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of HepG2 cell lysate with MGST2 polyclonal antibody (Cat # PAB29911).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human muscle with MGST2 polyclonal antibody (Cat # PAB29911).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4258
  • Gene Name:
  • MGST2
  • Gene Alias:
  • FLJ27438,GST2,MGC14097,MGST-II
  • Gene Description:
  • microsomal glutathione S-transferase 2
  • Gene Summary:
  • The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164539,microsomal GST-2,microsomal GST-II,truncated microsomal glutathione S-transferase 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook