Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF3G polyclonal antibody

  • Catalog # : PAB29909
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human EIF3G.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 218-267 of human EIF3G.
  • Sequence:
  • LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 35
  • Reactivity:
  • Human, Mouse
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:250)
    Immunoprecipitation
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to one week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Jurkat cell lysate with EIF3G polyclonal antibody (Cat # PAB29909).
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of MCF7 cell lysate with EIF3G polyclonal antibody (Cat # PAB29909).
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of 293T cell lysate with EIF3G polyclonal antibody (Cat # PAB29909).
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human brain stem cells with EIF3G polyclonal antibody (Cat # PAB29909).
  • Immunoprecipitation
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunoprecipitation
  • Gene Information
  • Entrez GeneID:
  • 8666
  • Gene Name:
  • EIF3G
  • Gene Alias:
  • EIF3-P42,EIF3S4,eIF3-delta,eIF3-p44
  • Gene Description:
  • eukaryotic translation initiation factor 3, subunit G
  • Other Designations:
  • eIF-3 RNA-binding subunit,eukaryotic translation initiation factor 3 subunit p42,eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD),eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook