Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LHX6 polyclonal antibody

  • Catalog # : PAB29906
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human LHX6.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 287-336 of human LHX6.
  • Sequence:
  • LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 40
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:250)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to one week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of HepG2 cell lysate with LHX6 polyclonal antibody (Cat # PAB29906).
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of 293T cell lysate with LHX6 polyclonal antibody (Cat # PAB29906).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with LHX6 polyclonal antibody (Cat # PAB29906).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • LHX6
  • Gene Alias:
  • LHX6.1,MGC119542,MGC119544,MGC119545
  • Gene Description:
  • LIM homeobox 6
  • Gene Summary:
  • This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • LIM homeobox protein 6,LIM homeodomain protein 6.1,OTTHUMP00000022046,OTTHUMP00000064113,OTTHUMP00000064114,OTTHUMP00000196635
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook