Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KRT15 polyclonal antibody

  • Catalog # : PAB29899
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human KRT15.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 407-456 of human KRT15.
  • Sequence:
  • RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 49
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:250)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to one week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western blot analysis of human fetal brain tissue lysate with KRT15 polyclonal antibody (Cat # PAB29899).
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Hela cell lysate with KRT15 polyclonal antibody (Cat # PAB29899).
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of HepG2 cell lysate with KRT15 polyclonal antibody (Cat # PAB29899).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with KRT15 polyclonal antibody (Cat # PAB29899).
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3866
  • Gene Name:
  • KRT15
  • Gene Alias:
  • CK15,K15,K1CO
  • Gene Description:
  • keratin 15
  • Gene Summary:
  • The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000165060,cytokeratin 15,keratin-15, basic,keratin-15, beta,type I cytoskeletal 15
  • RSS
  • YouTube
  • Linkedin
  • Facebook