Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBPMS polyclonal antibody

  • Catalog # : PAB29896
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human RBPMS.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 43-92 of human RBPMS.
  • Sequence:
  • LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 24
  • Reactivity:
  • Human, Mouse
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunocytochemistry (1:250)
    Immunohistochemistry (1:250)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to one week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western blot analysis of human liver tissue lysate with RBPMS polyclonal antibody (Cat # PAB29896).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with RBPMS polyclonal antibody (Cat # PAB29896).
  • Immunocytochemistry
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Immunocytochemistry
  • Gene Information
  • Gene Name:
  • RBPMS
  • Gene Alias:
  • HERMES
  • Gene Description:
  • RNA binding protein with multiple splicing
  • Gene Summary:
  • This gene encodes a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. The protein encoded by this gene has a single, putative RRM domain in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • RNA-binding protein with multiple splicing
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook