SF3A1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of 721_B cell lysate with SF3A1 polyclonal antibody (Cat # PAB29879).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart with SF3A1 polyclonal antibody (Cat # PAB29879).
Immunofluorescence
Immunofluorescent staining of HeLa cell with SF3A1 polyclonal antibody (Cat # PAB29879) under 4 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial synthetic protein of human SF3A1.
Immunogen
A synthetic peptide corresponding to amino acids 121-170 of human SF3A1.
Sequence
QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT
Host
Rabbit
Theoretical MW (kDa)
89
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1:250)
Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C for up to 1 week. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of 721_B cell lysate with SF3A1 polyclonal antibody (Cat # PAB29879).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart with SF3A1 polyclonal antibody (Cat # PAB29879).Immunofluorescence
Immunofluorescent staining of HeLa cell with SF3A1 polyclonal antibody (Cat # PAB29879) under 4 ug/mL working concentration. -
Gene Info — SF3A1
Entrez GeneID
10291Protein Accession#
Q15459Gene Name
SF3A1
Gene Alias
PRP21, PRPF21, SAP114, SF3A120
Gene Description
splicing factor 3a, subunit 1, 120kDa
Omim ID
605595Gene Ontology
HyperlinkGene Summary
This gene encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
pre-mRNA processing 21|pre-mRNA splicing factor SF3a (120 kDa subunit)|spliceosome associated protein 114
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com