Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EDF1 polyclonal antibody

  • Catalog # : PAB29872
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human EDF1.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 1-50 of human EDF1.
  • Sequence:
  • MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 16
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1:200)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to 1 week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of THP-1 cell lysate with EDF1 polyclonal antibody (Cat # PAB29872).
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human fibroblasts with EDF1 polyclonal antibody (Cat # PAB29872) under 5 ug/mL working concentration.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8721
  • Gene Name:
  • EDF1
  • Gene Alias:
  • EDF-1,MBF1,MGC9058
  • Gene Description:
  • endothelial differentiation-related factor 1
  • Gene Summary:
  • This gene encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022616,OTTHUMP00000022617,multiprotein bridging factor 1,multiprotein bridging factor-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook