Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HTR3B polyclonal antibody

  • Catalog # : PAB29870
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human HTR3B.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 8-57 of human HTR3B.
  • Sequence:
  • PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 49
  • Reactivity:
  • Human, Mouse
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1:250)
    Immunohistochemistry (1:250)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to 1 week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Jurkat cell lysate with HTR3B polyclonal antibody (Cat # PAB29870).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen with HTR3B polyclonal antibody (Cat # PAB29870).
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of mouse spinal cord with HTR3B polyclonal antibody (Cat # PAB29870).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9177
  • Gene Name:
  • HTR3B
  • Gene Alias:
  • 5-HT3B
  • Gene Description:
  • 5-hydroxytryptamine (serotonin) receptor 3B
  • Gene Summary:
  • The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. [provided by RefSeq
  • Other Designations:
  • 5-hydroxytryptamine 3 receptor B subunit,serotonin-gated ion channel subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook