Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HOXB7 polyclonal antibody

  • Catalog # : PAB29868
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human HOXB7.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 168-217 of human HOXB7.
  • Sequence:
  • IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 24
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1:250)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to 1 week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of HOXB7 transfected HEK 293T cell lysate with HOXB7 polyclonal antibody (Cat # PAB29868).
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of (A) HCT-116 and (B) SK-OV-3 cells with HOXB7 polyclonal antibody (Cat # PAB29868) under 4 ug/mL working concentration.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3217
  • Gene Name:
  • HOXB7
  • Gene Alias:
  • HHO.C1,HOX2,HOX2C,Hox-2.3
  • Gene Description:
  • homeobox B7
  • Gene Summary:
  • This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq
  • Other Designations:
  • homeo box 2C,homeo box B7,homeo box c1 protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook