Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TEAD4 polyclonal antibody

  • Catalog # : PAB29867
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial synthetic protein of human TEAD4.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 295-344 of human TEAD4.
  • Sequence:
  • LVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEK
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 44
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1:250)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C for up to 1 week. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of TEAD4 transfected HEK 293T cell lysate with TEAD4 polyclonal antibody (Cat # PAB29867).
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of HeLa cell with TEAD4 polyclonal antibody (Cat # PAB29867) under 4 ug/mL working concentration.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7004
  • Gene Name:
  • TEAD4
  • Gene Alias:
  • EFTR-2,MGC9014,RTEF1,TCF13L1,TEF-3,TEFR-1,hRTEF-1B
  • Gene Description:
  • TEA domain family member 4
  • Gene Summary:
  • This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq
  • Other Designations:
  • related transcription enhancer factor 1B,transcription factor 13-like 1,transcriptional enhancer factor 1-related,transcriptional enhancer factor 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook