Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD300A polyclonal antibody

  • Catalog # : PAB29578
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human CD300A.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 98-149 of human CD300A.
  • Sequence:
  • SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver shows strong cytoplasmic positivity in Kupffer cells with CD300A polyclonal antibody (Cat # PAB29578) at 1:20 - 1:50 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • CD300A
  • Gene Alias:
  • CMRF-35-H9,CMRF-35H,CMRF35H,CMRF35H9,IGSF12,IRC1,IRC2,IRp60
  • Gene Description:
  • CD300a molecule
  • Gene Summary:
  • The CMRF35 antigen (CMRF35A; MIM 606786), which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes. CMRF35H is recognized by the same antibody and is distinct from CMRF35 (Green et al., 1998 [PubMed 9701027]).[supplied by OMIM
  • Other Designations:
  • CD300a antigen,CMRF35H leukocyte immunoglobulin-like receptor,leukocyte membrane antigen
  • RSS
  • YouTube
  • Linkedin
  • Facebook