CCT2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with CCT2 polyclonal antibody (Cat # PAB29532).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with CCT2 polyclonal antibody (Cat # PAB29532) shows moderate positivity in chief cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human CCT2.
Immunogen
Recombinant protein corresponding to human CCT2.
Sequence
DALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDN
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with CCT2 polyclonal antibody (Cat # PAB29532).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with CCT2 polyclonal antibody (Cat # PAB29532) shows moderate positivity in chief cells. -
Gene Info — CCT2
Entrez GeneID
10576Gene Name
CCT2
Gene Alias
99D8.1, CCT-beta, CCTB, MGC142074, MGC142076, PRO1633, TCP-1-beta
Gene Description
chaperonin containing TCP1, subunit 2 (beta)
Omim ID
605139Gene Ontology
HyperlinkGene Summary
This gene encodes a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of the gene described in this record have been observed but have not been thoroughly characterized. [provided by RefSeq
Other Designations
T-complex protein 1 subunit beta|T-complex protein 1, beta subunit|chaperonin containing TCP1, subunit 2|chaperonin containing t-complex polypeptide 1, beta subunit|chaperonin containing t-complex polypeptide 1, subunit 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com