Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ECH1 polyclonal antibody

  • Catalog # : PAB29527
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human ECH1.
  • Immunogen:
  • Recombinant protein corresponding to human ECH1.
  • Sequence:
  • ISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp with ECH1 polyclonal antibody (Cat # PAB29527).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human liver with ECH1 polyclonal antibody (Cat # PAB29527) shows strong cytoplasmic positivity in hepatocytes.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1891
  • Gene Name:
  • ECH1
  • Gene Alias:
  • HPXEL
  • Gene Description:
  • enoyl Coenzyme A hydratase 1, peroxisomal
  • Gene Summary:
  • This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators. [provided by RefSeq
  • Other Designations:
  • delta3,5-delta2,4-dienoyl-CoA isomerase,dienoyl-CoA isomerase,peroxisomal enoyl-CoA hydratase 1,peroxisomal enoyl-coenzyme A hydratase-like protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook