UBA1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with UBA1 polyclonal antibody (Cat # PAB29508).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with UBA1 polyclonal antibody (Cat # PAB29508) shows distinct nuclear positivity in glial cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human UBA1.
Immunogen
Recombinant protein corresponding to human UBA1.
Sequence
LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with UBA1 polyclonal antibody (Cat # PAB29508).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with UBA1 polyclonal antibody (Cat # PAB29508) shows distinct nuclear positivity in glial cells. -
Gene Info — UBA1
Entrez GeneID
7317Gene Name
UBA1
Gene Alias
A1S9, A1S9T, A1ST, AMCX1, GXP1, MGC4781, SMAX2, UBA1A, UBE1, UBE1X
Gene Description
ubiquitin-like modifier activating enzyme 1
Omim ID
314370Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq
Other Designations
A1S9T and BN75 temperature sensitivity complementing|OTTHUMP00000023197|OTTHUMP00000023198|UBA1, ubiquitin-activating enzyme E1 homolog A|ubiquitin-activating enzyme E1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com