Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TCF3 polyclonal antibody

  • Catalog # : PAB29500
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • TCF3 polyclonal antibody raised against recombinant human TCF3.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human TCF3.
  • Sequence:
  • RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with TCF3 polyclonal antibody (Cat# PAB29500) shows strong nuclear positivity in a subset of cells in seminiferus ducts.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of MCF-7 cells with TCF3 polyclonal antibody (Cat# PAB29500) under 1-4 ug/mL working concentration shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6929
  • Gene Name:
  • TCF3
  • Gene Alias:
  • E2A,ITF1,MGC129647,MGC129648,bHLHb21
  • Gene Description:
  • transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
  • Gene Summary:
  • The TCF3 gene, also called E2A, encodes 2 basic helix-loop-helix (bHLH) transcription factors, E12 and E47, through alternative splicing. E12 and E47 are involved in regulation of immunoglobulin gene expression (Bain et al., 1994 [PubMed 8001125]).[supplied by OMIM
  • Other Designations:
  • E2A immunoglobulin enhancer-binding factor E12/E47,immunoglobulin transcription factor 1,kappa-E2-binding factor,transcription factor 3,transcription factor E2-alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook