Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Scientific Image Contest
pathway

PRNP polyclonal antibody

  • Catalog # : PAB29494
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • PRNP polyclonal antibody raised against recombinant human PRNP.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human PRNP.
  • Sequence:
  • GSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with PRNP polyclonal antibody (Cat# PAB29494) shows moderate cytoplasmic positivity in Purkinje cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-2 OS cells with PRNP polyclonal antibody (Cat# PAB29494) under 1-4 ug/mL working concentration shows positivity in nuclear membrane and cytoplasm. Antibody staining is shown in green.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5621
  • Gene Name:
  • PRNP
  • Gene Alias:
  • ASCR,CD230,CJD,GSS,MGC26679,PRIP,PrP,PrP27-30,PrP33-35C,PrPc,prion
  • Gene Description:
  • prion protein
  • Gene Summary:
  • The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq
  • Other Designations:
  • CD230 antigen,OTTHUMP00000030162,OTTHUMP00000030163,major prion protein,p27-30,prion protein PrP,prion-related protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook