Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC3A2 polyclonal antibody

  • Catalog # : PAB29491
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • SLC3A2 polyclonal antibody raised against recombinant human SLC3A2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human SLC3A2.
  • Sequence:
  • KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:2500-1:5000)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate) analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with SLC3A2 polyclonal antibody (Cat# PAB29491) at 1:100 - 1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SLC3A2 polyclonal antibody (Cat# PAB29491) shows strong membranous positivity in tubular cells at 1:2500 - 1:5000 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-2 OS cells with SLC3A2 polyclonal antibody (Cat# PAB29491) under 1-4 ug/mL working concentration shows positivity in nucleus, plasma membrane and cytoplasm. Antibody staining is shown in green.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6520
  • Gene Name:
  • SLC3A2
  • Gene Alias:
  • 4F2,4F2HC,4T2HC,CD98,CD98HC,MDU1,NACAE
  • Gene Description:
  • solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2
  • Gene Summary:
  • This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein with an alpha amylase domain. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. It associates with integrins and mediates integrin-dependent signaling related to normal cell growth and tumorigenesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • 4F2 cell-surface antigen heavy chain,4F2 heavy chain,CD98 heavy chain,antigen defined by monoclonal antibody 4F2, heavy chain,antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43,heavy chain,lymphocyte activation antigen 4F2 large subu
  • RSS
  • YouTube
  • Linkedin
  • Facebook