SLC3A2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with SLC3A2 polyclonal antibody (Cat# PAB29491) at 1:100 - 1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SLC3A2 polyclonal antibody (Cat# PAB29491) shows strong membranous positivity in tubular cells at 1:2500 - 1:5000 dilution.
Immunofluorescence
Immunofluorescent staining of U-2 OS cells with SLC3A2 polyclonal antibody (Cat# PAB29491) under 1-4 ug/mL working concentration shows positivity in nucleus, plasma membrane and cytoplasm. Antibody staining is shown in green.
-
Specification
Product Description
SLC3A2 polyclonal antibody raised against recombinant human SLC3A2.
Immunogen
Recombinant protein corresponding to amino acids of human SLC3A2.
Sequence
KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:2500-1:5000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with SLC3A2 polyclonal antibody (Cat# PAB29491) at 1:100 - 1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SLC3A2 polyclonal antibody (Cat# PAB29491) shows strong membranous positivity in tubular cells at 1:2500 - 1:5000 dilution.Immunofluorescence
Immunofluorescent staining of U-2 OS cells with SLC3A2 polyclonal antibody (Cat# PAB29491) under 1-4 ug/mL working concentration shows positivity in nucleus, plasma membrane and cytoplasm. Antibody staining is shown in green. -
Gene Info — SLC3A2
Entrez GeneID
6520Protein Accession#
P08195Gene Name
SLC3A2
Gene Alias
4F2, 4F2HC, 4T2HC, CD98, CD98HC, MDU1, NACAE
Gene Description
solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2
Omim ID
158070Gene Ontology
HyperlinkGene Summary
This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein with an alpha amylase domain. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. It associates with integrins and mediates integrin-dependent signaling related to normal cell growth and tumorigenesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
4F2 cell-surface antigen heavy chain|4F2 heavy chain|CD98 heavy chain|antigen defined by monoclonal antibody 4F2, heavy chain|antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43|heavy chain|lymphocyte activation antigen 4F2 large subu
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com