Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCAR polyclonal antibody

  • Catalog # : PAB29489
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • FCAR polyclonal antibody raised against recombinant human FCAR.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human FCAR.
  • Sequence:
  • NWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG sp, Lane 3: Human plasma (IgG/HSA depleted), Lane 4: Human liver tissue, with FCAR polyclonal antibody (Cat# PAB29489) at 1:100 - 1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with FCAR polyclonal antibody (Cat# PAB29489) shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra at 1:50 - 1:200 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-251 MG cells with FCAR polyclonal antibody (Cat# PAB29489) under 1-4 ug/mL working concentration shows positivity in vesicles. Antibody staining is shown in green.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2204
  • Gene Name:
  • FCAR
  • Gene Alias:
  • CD89
  • Gene Description:
  • Fc fragment of IgA, receptor for
  • Gene Summary:
  • This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • Fc alpha receptor,IgA Fc receptor,OTTHUMP00000068692,OTTHUMP00000068696,OTTHUMP00000068697,OTTHUMP00000068698
  • RSS
  • YouTube
  • Linkedin
  • Facebook