Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF14 polyclonal antibody

  • Catalog # : PAB29485
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • TNFRSF14 polyclonal antibody raised against recombinant human TNFRSF14.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human TNFRSF14.
  • Sequence:
  • PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:20-1:50)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate) analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG sp cell lysate with TNFRSF14 polyclonal antibody (Cat# PAB29485) at 1:100 - 1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with TNFRSF14 polyclonal antibody (Cat# PAB29485) shows strong cytoplasmic positivity in glandular cells at 1:20 - 1:50 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-2 OS cells with TNFRSF14 polyclonal antibody (Cat# PAB29485) under 1-4 ug/mL working concentration shows positivity in cytoplasm. Antibody staining is shown in green.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8764
  • Gene Name:
  • TNFRSF14
  • Gene Alias:
  • ATAR,HVEA,HVEM,LIGHTR,TR2
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. [provided by RefSeq
  • Other Designations:
  • CD40-like protein,OTTHUMP00000000866,herpesvirus entry mediator A,tumor necrosis factor receptor superfamily, member 14,tumor necrosis factor receptor-like gene2
  • RSS
  • YouTube
  • Linkedin
  • Facebook