COPB1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of RT-4 cell lysate with COPB1 polyclonal antibody (Cat# PAB29484) at 1:100 - 1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with COPB1 polyclonal antibody (Cat# PAB29484) shows cytoplasmic positivity in cells in seminiferus ducts at 1:20 - 1:50 dilution.
Immunofluorescence
Immunofluorescent staining of RH-30 cells with COPB1 polyclonal antibody (Cat# PAB29484) under 1-4 ug/mL working concentration shows positivity in cytoplasm and the Golgi apparatus. Antibody staining is shown in green.
-
Specification
Product Description
COPB1 polyclonal antibody raised against recombinant human COPB1.
Immunogen
Recombinant protein corresponding to amino acids of human COPB1.
Sequence
NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of RT-4 cell lysate with COPB1 polyclonal antibody (Cat# PAB29484) at 1:100 - 1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with COPB1 polyclonal antibody (Cat# PAB29484) shows cytoplasmic positivity in cells in seminiferus ducts at 1:20 - 1:50 dilution.Immunofluorescence
Immunofluorescent staining of RH-30 cells with COPB1 polyclonal antibody (Cat# PAB29484) under 1-4 ug/mL working concentration shows positivity in cytoplasm and the Golgi apparatus. Antibody staining is shown in green. -
Gene Info — COPB1
Entrez GeneID
1315Protein Accession#
P53618Gene Name
COPB1
Gene Alias
COPB, DKFZp761K102, FLJ10341
Gene Description
coatomer protein complex, subunit beta 1
Omim ID
600959Gene Ontology
HyperlinkGene Summary
This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
beta coat protein|coatomer protein complex, subunit beta
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com