Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COPB1 polyclonal antibody

  • Catalog # : PAB29484
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • COPB1 polyclonal antibody raised against recombinant human COPB1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human COPB1.
  • Sequence:
  • NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:20-1:50)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate) analysis of RT-4 cell lysate with COPB1 polyclonal antibody (Cat# PAB29484) at 1:100 - 1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with COPB1 polyclonal antibody (Cat# PAB29484) shows cytoplasmic positivity in cells in seminiferus ducts at 1:20 - 1:50 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of RH-30 cells with COPB1 polyclonal antibody (Cat# PAB29484) under 1-4 ug/mL working concentration shows positivity in cytoplasm and the Golgi apparatus. Antibody staining is shown in green.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1315
  • Gene Name:
  • COPB1
  • Gene Alias:
  • COPB,DKFZp761K102,FLJ10341
  • Gene Description:
  • coatomer protein complex, subunit beta 1
  • Gene Summary:
  • This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq
  • Other Designations:
  • beta coat protein,coatomer protein complex, subunit beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook