Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAND1 polyclonal antibody

  • Catalog # : PAB29483
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • CAND1 polyclonal antibody raised against recombinant human CAND1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human CAND1.
  • Sequence:
  • QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:1000-1:2500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG, Lane 3: Human plasma, Lane 4: Human Liver tissue, Lane 5: Human Tonsil tissue with CAND1 polyclonal antibody (Cat# PAB29483) at 1:100 - 1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with CAND1 polyclonal antibody (Cat# PAB29483) shows moderate cytoplasmic and nuclear positivity in renal tubules at 1:1000 - 1:2500 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of SiHa cells with CAND1 polyclonal antibody (Cat# PAB29483) under 1-4 ug/mL working concentration shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • CAND1
  • Gene Alias:
  • DKFZp434M1414,FLJ10114,FLJ10929,FLJ38691,FLJ90441,KIAA0829,TIP120,TIP120A
  • Gene Description:
  • cullin-associated and neddylation-dissociated 1
  • Other Designations:
  • TBP interacting protein,TBP-interacting protein,TIP120 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook