Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PELI3 polyclonal antibody

  • Catalog # : PAB29481
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • PELI3 polyclonal antibody raised against recombinant human PELI3.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human PELI3.
  • Sequence:
  • RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with PELI3 polyclonal antibody (Cat# PAB29481) shows strong cytoplasmic positivity in Purkinje cells while additional nuclear membranous staining in cells in molecular layer.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of A-431 cells with PELI3 polyclonal antibody (Cat# PAB29481) under 1-4 ug/mL working concentration shows positivity in vesicles and nucleus but excluded from the nucleoli. Antibody staining is shown in green.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • PELI3
  • Gene Alias:
  • MGC35521
  • Gene Description:
  • pellino homolog 3 (Drosophila)
  • Gene Summary:
  • Toll-like receptors (TLRs; see MIM 603030) and IL1R (IL1R1; MIM 147810) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R (Jensen and Whitehead, 2003 [PubMed 12874243]).[supplied by OMIM
  • Other Designations:
  • pellino 3 alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook