GAR1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot (Tissue lysate) analysis of human liver lysate with GAR1 polyclonal antibody (Cat# PAB29476) at 1:100 - 1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with GAR1 polyclonal antibody (Cat# PAB29476) shows strong nuclear positivity in glandular, endothelial and ganglion cells at 1:500 - 1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of U-2 OS cells with GAR1 polyclonal antibody (Cat# PAB29476) under 1-4 ug/mL working concentration shows positivity in nucleus and nucleoli. Antibody staining is shown in green.
-
Specification
Product Description
GAR1 polyclonal antibody raised against recombinant human GAR1.
Immunogen
Recombinant protein corresponding to amino acids of human GAR1.
Sequence
GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot (Tissue lysate) analysis of human liver lysate with GAR1 polyclonal antibody (Cat# PAB29476) at 1:100 - 1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with GAR1 polyclonal antibody (Cat# PAB29476) shows strong nuclear positivity in glandular, endothelial and ganglion cells at 1:500 - 1:1000 dilution.Immunofluorescence
Immunofluorescent staining of U-2 OS cells with GAR1 polyclonal antibody (Cat# PAB29476) under 1-4 ug/mL working concentration shows positivity in nucleus and nucleoli. Antibody staining is shown in green. -
Gene Info — GAR1
Entrez GeneID
54433Protein Accession#
Q9NY12Gene Name
GAR1
Gene Alias
NOLA1
Gene Description
GAR1 ribonucleoprotein homolog (yeast)
Omim ID
606468Gene Ontology
HyperlinkGene Summary
This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene. [provided by RefSeq
Other Designations
nucleolar protein family A member 1|nucleolar protein family A, member 1|nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com