RNF10 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG with RNF10 polyclonal antibody (Cat # PAB29448) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with RNF10 polyclonal antibody (Cat # PAB29448) shows strong cytoplasmic positivity in exocrine glandular cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with RNF10 polyclonal antibody (Cat # PAB29448) at 1-4 ug/mL concentration shows positivity in mitochondria and nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human RNF10.
Immunogen
Recombinant protein corresponding to human RNF10.
Sequence
SPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVV
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG with RNF10 polyclonal antibody (Cat # PAB29448) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with RNF10 polyclonal antibody (Cat # PAB29448) shows strong cytoplasmic positivity in exocrine glandular cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with RNF10 polyclonal antibody (Cat # PAB29448) at 1-4 ug/mL concentration shows positivity in mitochondria and nucleus but excluded from the nucleoli. -
Gene Info — RNF10
Entrez GeneID
9921Gene Name
RNF10
Gene Alias
KIAA0262, MGC126758, MGC126764, RIE2
Gene Description
ring finger protein 10
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spliced transcript variants, however, their full length nature is not known. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com