Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PVRL1 polyclonal antibody

  • Catalog # : PAB29417
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human PVRL1.
  • Immunogen:
  • Recombinant protein corresponding to human PVRL1.
  • Sequence:
  • DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:50-1:200)
    Immunofluorescence (1-4 ug/mL)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp with PVRL1 polyclonal antibody (Cat # PAB29417) at 1:100-1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human pancreas with PVRL1 polyclonal antibody (Cat # PAB29417) shows strong cytoplasmic and membranous positivity in intercalated ducts at 1:50-1:200 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-2 OS with PVRL1 polyclonal antibody (Cat # PAB29417) at 1-4 ug/mL concentration shows positivity in nucleus but excluded from the nucleoli.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5818
  • Gene Name:
  • PVRL1
  • Gene Alias:
  • CD111,CLPED1,ED4,HIgR,HVEC,MGC142031,MGC16207,OFC7,PRR,PRR1,PVRR,PVRR1,SK-12,nectin-1
  • Gene Description:
  • poliovirus receptor-related 1 (herpesvirus entry mediator C)
  • Other Designations:
  • ectodermal dysplasia 4 (Margarita Island type),herpesvirus entry mediator C,nectin 1,poliovirus receptor related,poliovirus receptor-like 1,poliovirus receptor-related 1,poliovirus receptor-related 1 (herpesvirus entry mediator C; nectin)
  • RSS
  • YouTube
  • Linkedin
  • Facebook