RPL9 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp with RPL9 polyclonal antibody (Cat # PAB29404).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with RPL9 polyclonal antibody (Cat # PAB29404) shows strong cytoplasmic positivity in exocrine glandular cells.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with RPL9 polyclonal antibody (Cat # PAB29404) at 1-4 ug/mL concentration shows positivity in nucleoli and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human RPL9.
Immunogen
Recombinant protein corresponding to human RPL9.
Sequence
SVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry
Immunofluorescence (1-4 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp with RPL9 polyclonal antibody (Cat # PAB29404).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with RPL9 polyclonal antibody (Cat # PAB29404) shows strong cytoplasmic positivity in exocrine glandular cells.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with RPL9 polyclonal antibody (Cat # PAB29404) at 1-4 ug/mL concentration shows positivity in nucleoli and cytoplasm. -
Gene Info — RPL9
Entrez GeneID
6133Gene Name
RPL9
Gene Alias
DKFZp313J1510, FLJ27456, MGC15545, NPC-A-16
Gene Description
ribosomal protein L9
Omim ID
603686Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
60S ribosomal protein L9|OTTHUMP00000125205
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com