FBXO44 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate) Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with FBXO44 polyclonal antibody (Cat # PAB29402) at 1:500-1:1000 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with FBXO44 polyclonal antibody (Cat # PAB29402) shows strong nuclear and cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with FBXO44 polyclonal antibody (Cat # PAB29402) at 1-4 ug/mL concentration shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human FBXO44.
Immunogen
Recombinant protein corresponding to human FBXO44.
Sequence
SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate) Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with FBXO44 polyclonal antibody (Cat # PAB29402) at 1:500-1:1000 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with FBXO44 polyclonal antibody (Cat # PAB29402) shows strong nuclear and cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with FBXO44 polyclonal antibody (Cat # PAB29402) at 1-4 ug/mL concentration shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — FBXO44
Entrez GeneID
93611Gene Name
FBXO44
Gene Alias
DKFZp781J0852, FBG3, FBX30, FBX6A, Fbx44, Fbxo6a, MGC14140
Gene Description
F-box protein 44
Omim ID
609111Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Four alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
F-box gene 3|F-box protein FBX30|OTTHUMP00000002063|OTTHUMP00000002064|OTTHUMP00000002065|OTTHUMP00000035896|OTTHUMP00000044368
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com