ALDOC polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with ALDOC polyclonal antibody (Cat # PAB29393) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human hippocampus with ALDOC polyclonal antibody (Cat # PAB29393) shows strong positivity in subsets of glial cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with ALDOC polyclonal antibody (Cat # PAB29393) at 1-4 ug/mL concentration shows positivity in nucleus, nucleoli and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human ALDOC.
Immunogen
Recombinant protein corresponding to human ALDOC.
Sequence
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVI
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with ALDOC polyclonal antibody (Cat # PAB29393) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human hippocampus with ALDOC polyclonal antibody (Cat # PAB29393) shows strong positivity in subsets of glial cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with ALDOC polyclonal antibody (Cat # PAB29393) at 1-4 ug/mL concentration shows positivity in nucleus, nucleoli and cytoplasm. -
Gene Info — ALDOC
Entrez GeneID
230Gene Name
ALDOC
Gene Alias
ALDC
Gene Description
aldolase C, fructose-bisphosphate
Omim ID
103870Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively. [provided by RefSeq
Other Designations
OTTHUMP00000163437|aldolase 3|brain-type aldolase|fructoaldolase C|fructose-1,6-biphosphate triosephosphate lyase|fructose-bisphosphate aldolase C
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com