GABPA polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp Lane 3: Human liver tissue Lane 4: Human tonsil tissue with GABPA polyclonal antibody (Cat # PAB29389) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lymph node with GABPA polyclonal antibody (Cat # PAB29389) shows strong nuclear positivity in lymphoid cells outside reaction centra at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with GABPA polyclonal antibody (Cat # PAB29389) at 1-4 ug/mL concentration shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human GABPA.
Immunogen
Recombinant protein corresponding to human GABPA.
Sequence
EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp Lane 3: Human liver tissue Lane 4: Human tonsil tissue with GABPA polyclonal antibody (Cat # PAB29389) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lymph node with GABPA polyclonal antibody (Cat # PAB29389) shows strong nuclear positivity in lymphoid cells outside reaction centra at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with GABPA polyclonal antibody (Cat # PAB29389) at 1-4 ug/mL concentration shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — GABPA
Entrez GeneID
2551Gene Name
GABPA
Gene Alias
E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A
Gene Description
GA binding protein transcription factor, alpha subunit 60kDa
Omim ID
600609Gene Ontology
HyperlinkGene Summary
This gene encodes one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. This subunit also shares identity with a subunit constituting the transcription factor E4TF1, responsible for expression of the adenovirus E4 gene. Because of its chromosomal localization and ability to form heterodimers with other polypeptides, this gene may play a role in the Down Syndrome phenotype. [provided by RefSeq
Other Designations
GA binding protein transcription factor, alpha subunit|OTTHUMP00000096114|human nuclear respiratory factor-2 subunit alpha|nuclear respiratory factor 2 alpha subunit
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com