NF2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with NF2 polyclonal antibody (Cat # PAB29385) at 1:500-1:1000 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with NF2 polyclonal antibody (Cat # PAB29385) shows strong cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with NF2 polyclonal antibody (Cat # PAB29385) at 1-4 ug/mL concentration shows positivity in plasma membrane and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human NF2.
Immunogen
Recombinant protein corresponding to human NF2.
Sequence
ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with NF2 polyclonal antibody (Cat # PAB29385) at 1:500-1:1000 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with NF2 polyclonal antibody (Cat # PAB29385) shows strong cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with NF2 polyclonal antibody (Cat # PAB29385) at 1-4 ug/mL concentration shows positivity in plasma membrane and cytoplasm. -
Gene Info — NF2
Entrez GeneID
4771Gene Name
NF2
Gene Alias
ACN, BANF, SCH
Gene Description
neurofibromin 2 (merlin)
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts. [provided by RefSeq
Other Designations
merlin|moesin-ezrin-radixin like|moesin-ezrin-radizin-like protein|neurofibromin 2|neurofibromin 2 (bilateral acoustic neuroma)|schwannomerlin|schwannomin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com