HSPD1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human HSPD1.
Immunogen
Recombinant protein corresponding to human HSPD1.
Sequence
RVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAEL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with HSPD1 polyclonal antibody (Cat # PAB29369) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with HSPD1 polyclonal antibody (Cat # PAB29369) shows strong cytoplasmic positivity in cells of renal tubules at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with HSPD1 polyclonal antibody (Cat # PAB29369) at 1-4 ug/mL concentration shows positivity in mitochondria. -
Gene Info — HSPD1
Entrez GeneID
3329Gene Name
HSPD1
Gene Alias
CPN60, GROEL, HLD4, HSP60, HSP65, HuCHA60, SPG13
Gene Description
heat shock 60kDa protein 1 (chaperonin)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria. This gene is adjacent to a related family member and the region between the 2 genes functions as a bidirectional promoter. Two pseudogenes, both located on chromosome 8, have been associated with this gene. Two transcript variants encoding the same protein have been identified for this gene. Mutations associated with this gene cause autosomal recessive spastic paraplegia 13. [provided by RefSeq
Other Designations
P60 lymphocyte protein|chaperonin|heat shock 60kD protein 1 (chaperonin)|heat shock protein 65|mitochondrial heat shock 60kD protein 1 variant 1|mitochondrial matrix protein P1|short heat shock protein 60 Hsp60s1|spastic paraplegia 13 (autosomal dominant)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com