SOD1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with SOD1 polyclonal antibody (Cat # PAB29364) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human liver with SOD1 polyclonal antibody (Cat # PAB29364) shows nuclear and cytoplasmic positivity in hepatocytes at 1:2500-1:5000 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human SOD1.
Immunogen
Recombinant protein corresponding to human SOD1.
Sequence
PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:2500-1:5000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with SOD1 polyclonal antibody (Cat # PAB29364) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human liver with SOD1 polyclonal antibody (Cat # PAB29364) shows nuclear and cytoplasmic positivity in hepatocytes at 1:2500-1:5000 dilution. -
Gene Info — SOD1
Entrez GeneID
6647Gene Name
SOD1
Gene Alias
ALS, ALS1, IPOA, SOD, homodimer
Gene Description
superoxide dismutase 1, soluble
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene. [provided by RefSeq
Other Designations
Cu /Zn superoxide dismutase|Cu/Zn superoxide dismutase|SOD, soluble|indophenoloxidase A|superoxide dismutase, cystolic
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com