HSPA9 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with HSPA9 polyclonal antibody (Cat # PAB29350) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with HSPA9 polyclonal antibody (Cat # PAB29350) shows strong cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with HSPA9 polyclonal antibody (Cat # PAB29350) at 1-4 ug/mL concentration shows positivity in mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human HSPA9.
Immunogen
Recombinant protein corresponding to human HSPA9.
Sequence
GIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGT
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with HSPA9 polyclonal antibody (Cat # PAB29350) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with HSPA9 polyclonal antibody (Cat # PAB29350) shows strong cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with HSPA9 polyclonal antibody (Cat # PAB29350) at 1-4 ug/mL concentration shows positivity in mitochondria. -
Gene Info — HSPA9
Entrez GeneID
3313Gene Name
HSPA9
Gene Alias
CSA, GRP75, HSPA9B, MGC4500, MOT, MOT2, MTHSP75, PBP74, mot-2
Gene Description
heat shock 70kDa protein 9 (mortalin)
Omim ID
600548Gene Ontology
HyperlinkGene Summary
The product encoded by this gene belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. This gene encodes a heat-shock cognate protein. This protein plays a role in the control of cell proliferation. It may also act as a chaperone. [provided by RefSeq
Other Designations
75 kDa glucose regulated protein|heat shock 70kD protein 9|heat shock 70kD protein 9B|heat shock 70kDa protein 9|heat shock 70kDa protein 9B (mortalin-2)|mortalin, perinuclear|mortalin-2|p66-mortalin|peptide-binding protein 74|stress-70 protein, mitochond
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com