CDH17 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate); Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with CDH17 polyclonal antibody (Cat# PAB29342) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human small intestine with CDH17 polyclonal antibody (Cat# PAB29342) shows membranous and cytoplasmic positivity in glandular cells at 1:1000-1:2500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A549 with CDH17 polyclonal antibody (Cat# PAB29342) under 1-4 ug/mL working concentration shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human CDH17.
Immunogen
Recombinant protein corresponding to amino acids of human CDH17.
Sequence
INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate); Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with CDH17 polyclonal antibody (Cat# PAB29342) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human small intestine with CDH17 polyclonal antibody (Cat# PAB29342) shows membranous and cytoplasmic positivity in glandular cells at 1:1000-1:2500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A549 with CDH17 polyclonal antibody (Cat# PAB29342) under 1-4 ug/mL working concentration shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — CDH17
Entrez GeneID
1015Protein Accession#
Q12864Gene Name
CDH17
Gene Alias
CDH16, FLJ26931, HPT-1, HPT1, MGC138218, MGC142024
Gene Description
cadherin 17, LI cadherin (liver-intestine)
Omim ID
603017Gene Ontology
HyperlinkGene Summary
This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
HPT-1 cadherin|LI cadherin|cadherin 17|cadherin-16|human intestinal peptide-associated transporter HPT-1|human peptide transporter 1|liver-intestine cadherin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com