CASP3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human CASP3.
Immunogen
Recombinant protein corresponding to amino acids of human CASP3.
Sequence
HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with CASP3 polyclonal antibody (Cat# PAB29334) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human bone marrow with CASP3 polyclonal antibody (Cat# PAB29334) shows strong cytoplasmic positivity in bone marrow poietic cells at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with CASP3 polyclonal antibody (Cat# PAB29334) under 1-4 ug/mL working concentration shows positivity in mitochondria and nucleus but excluded from the nucleoli. -
Gene Info — CASP3
Entrez GeneID
836Protein Accession#
A8MVM1Gene Name
CASP3
Gene Alias
CPP32, CPP32B, SCA-1
Gene Description
caspase 3, apoptosis-related cysteine peptidase
Omim ID
600636Gene Ontology
HyperlinkGene Summary
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. [provided by RefSeq
Other Designations
OTTHUMP00000165054|PARP cleavage protease|SREBP cleavage activity 1|Yama|apopain|caspase 3|caspase 3, apoptosis-related cysteine protease|cysteine protease CPP32|procaspase3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com